PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676711036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 1786aa    MW: 200432 Da    PI: 5.1388
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676711036genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.2e-18104160157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                ++kR   t+ qle+Le+ +  ++yps++ r++L+ kl+L++rq ++WF+ rR k++k
  676711036 104 KSKRKMKTAAQLEVLENTYSVEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 160
                679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1784160IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1598161IPR009057Homeodomain-like
PROSITE profilePS5007116.342101161IPR001356Homeobox domain
SMARTSM003895.2E-16103165IPR001356Homeobox domain
PfamPF000462.2E-15104160IPR001356Homeobox domain
CDDcd000862.54E-13104162No hitNo description
SMARTSM005713.7E-22615674IPR018501DDT domain
PROSITE profilePS5082715.96615674IPR018501DDT domain
PfamPF027915.7E-16616671IPR018501DDT domain
PfamPF050661.9E-15797864IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.3E-79991037IPR028942WHIM1 domain
PfamPF156131.1E-1211661238IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1786 aa     Download sequence    Send to blast
MSDRAAFQQV EKYITVCAND VTMTIETELL LGTIDAPLSL LHTHPSSFPE LTQKKTHRHH  60
HHFSQSLSPT SLIFYLELII ITKEMEGGSE AEKNKTPEGG SESKSKRKMK TAAQLEVLEN  120
TYSVEPYPSE AIRADLSVKL NLSDRQLQMW FCHRRLKDRK SSTPSKRQRK ESTPPVAESS  180
KQPAVNAADL LAGNELNSFA HELDSRRTVV RSGGGSAAGG GVTVVRRFNE PSHSEVRAIG  240
YVEAQLGERL RDDGPILGME FDPLPPGAFG TPIEMPSHRK APRPAFETNV YVRPDVKTVK  300
DSVRTIREYQ FLPEQPSSRT DHSERASPSH LYGVPLDASV LRASSVSGGY RDDYKISPQI  360
PNLNLSTHQG KAGHVSSPNL NEYDLPYQKS YVDPAAHGND DPFVKSEREV GNDDDEDEDD  420
LLLQLERKRK SEEARITREA EAHEKRIRKE LERQDMLRRK REEQIRKEME RQDRERRKEE  480
ERLLRERQRE EERYHKEQMR EMQRREKFLK KETIRAEKMR QKEEMRRVKE VARLKAANER  540
AMARKIAKES MELIEDERLE LMEVAALSQG LPSMVSLDFE TLQNLDAYRD KQVIFPPTSV  600
KLKKPFAMKP WNGSDENIAN LLMVWRFLIT FADVLGLWPF TLDEFTQSFH DYDPRLMGEI  660
HIVLLKTIIK DIEGVARTLS SGVGANQNAA ANPGGGHPHV VEGAYAWGFD IRSWRRNLNV  720
FTWPEILRQL ALSAGLGPQL KKQDIKTVSV HDDNEANNSE NVIFNLRIGA AAENAFAKMQ  780
ERGLSNPRRS RHRLTPGTVK FAAFHVLSIE GEKGLTILEV AEKIQKSGLR DLTTSRTPEA  840
SVAAALSRDT KLFERVAPST YCVRPSYRKD AADAETIFSE ARERIRMFKS GVTDVEDVDE  900
AERDEDSESD VGDDPEVDLN LKKEDPDAME VENLSDVKPV LENGKLDTVT MKTEPGLPRT  960
PSSLPESTKD EKIDDILPDQ SLEKTVANDE NSACFSKLGE QWVQGLVEGD YSNLSIEERL  1020
NALVALIGIA IEGNTIRIAL EERLEVASAL KKQMWSEVQL DKRWKEESLI RANYLSYPTP  1080
KIATPAFGNQ ESPSADVTPI SSQDPLSLSQ IDVNNAVAGP SLQLQENVSG MESLPYQQGY  1140
TADRERLRAQ LKAYVGYKAE ELYVYRSLPL GQDRRRNRYW RFSASASRND PGCGRIFVEL  1200
QDGRWRLIDS EEGFDYLVKS LDVRGVRESH LHFMLLKIEA SFKEAVRRNV ETNHELCSIS  1260
TGVDLDSDTA EISTTFKIEL GDSDGTERCG VMQRFQSFEK WMWDNMLHPG ALSAFKYGAK  1320
KSIPLFHICR SCAELHFVGD ICCPGCGQMM RGGLDGSELC FAEQVARLGE ISRGDPGFIL  1380
RGSNLSPLRI RLLKIQLALV EASLPPEGLQ ASWTEDLRKT WGLKLLSSSS PEELHQVLTM  1440
LEFALKRDFL SSNFETTSEL LGLPEDAVVS DLTSAVNVLP WIPKTTGGVA LRLFELDSSI  1500
VYTPDQNNDP QKDKESEEFV GVETSFLRNV QENDLVETTP VQVAYTQEEN WTESGLGGVS  1560
SSGRGRPPRG RGRPRSQRGK KPSLASGSAS ASGGRPPRGA ANSNGEPMLR PRTQPRGGRT  1620
NGRRSGTRSR TRPTKGTLGI SNEVVGVVGG RRAKEVNVNA KTSLRDNDEW VETPEMQDDE  1680
GEASSSGRSF QYDDVMAPVD DFDGVGESSK LVGRGEFSLH SDGEYEEEEE EEEDMDTKMG  1740
VNVDDEDYIN EDSDGREQPE ISIGAARKRF PFEDPDLTSS SSSDFQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199231.10.0protein RINGLET2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLD7MN210.0D7MN21_ARALL; Putative uncharacterized protein
STRINGAT5G44180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator